| Edit |   |
| Antigenic Specificity | RAD54 Homolog B (S. Cerevisiae) (RAD54B) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | RAD54B belongs to the DEAD-like helicase superfamily. It shares similarity with Saccharomyces cerevisiae RAD54 and RDH54, both of which are involved in homologous recombination and repair of DNA. This protein binds to double-stranded DNA, and displays ATPase activity in the presence of DNA. |
| Immunogen | RAD54 B antibody was raised using a synthetic peptide corresponding to a region with amino acids DAVLIVKGKSFILKNLEGKDIGRGIGYKFKELEKIEEGQTLMICGKEIEV |
| Other Names | RAD54B|im:7137737|im:7153525|fsbp|rdh54|RDH54|E130016E03Rik|Fsbp|RGD1306507 |
| Gene, Accession # | Gene ID: 25788,623474,313063 |
| Catalog # | ABIN634221 |
| Price | |
| Order / More Info | RAD54 Homolog B (S. Cerevisiae) (RAD54B) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |