| Edit |   |
| Antigenic Specificity | RAB39, Member RAS Oncogene Family (RAB39) (N-Term) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | RAB39 may be involved in vesicular trafficking. |
| Immunogen | RAB39 antibody was raised using the N terminal of RAB39 corresponding to a region with amino acids METIWIYQFRLIVIGDSTVGKSCLLHRFTQGRFPGLRSPACDPTVGVDFF |
| Other Names | RAB39|RAH|C230094F14Rik|Rab39a|Rab39 |
| Gene, Accession # | Gene ID: 83871 |
| Catalog # | ABIN633072 |
| Price | |
| Order / More Info | RAB39, Member RAS Oncogene Family (RAB39) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |