| Edit |   |
| Antigenic Specificity | Killer Cell Lectin-Like Receptor Subfamily F, Member 1 (KLRF1) (Middle Region) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | KLRF1, an activating homodimeric C-type lectin-like receptor (CTLR), is expressed on nearly all natural killer (NK) cells and stimulates their cytoxicity and cytokine release. |
| Immunogen | KLRF1 antibody was raised using the middle region of KLRF1 corresponding to a region with amino acids QKGSCSNATQYEDTGDLKVNNGTRRNISNKDLCASRSADQTVLCQSEWLK |
| Other Names | CLEC5C|NKp80|KLRF1|MGC152582 |
| Gene, Accession # | Gene ID: 51348 |
| Catalog # | ABIN634539 |
| Price | |
| Order / More Info | Killer Cell Lectin-Like Receptor Subfamily F, Member 1 (KLRF1) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |