| Edit |   |
| Antigenic Specificity | Left-Right Determination Factor 2 (LEFTY2) (N-Term) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | LEFTY2 is a member of the TGF-beta family of proteins. The protein is secreted and plays a role in left-right asymmetry determination of organ systems during development. The protein may also play a role in endometrial bleeding. Mutations in its gene have been associated with left-right axis malformations, particularly in the heart and lungs. Some types of infertility have been associated with dysregulated expression of its gene in the endometrium. |
| Immunogen | LEFTY2 antibody was raised using the N terminal of LEFTY2 corresponding to a region with amino acids MWPLWLCWALWVLPLAGPGAALTEEQLLGSLLRQLQLSEVPVLDRADMEK |
| Other Names | atv2|cb720|fe38b03|wu:fe38b03|LEFTY1|AI450052|Ebaf|Leftb|Stra3|Tgfb4|lefty|lefty-1|EBAF|LEFTA|LEFTYA|TGFB4|6030463A22Rik|AV214969|Lefta|Ebaf2 |
| Gene, Accession # | Gene ID: 7044 |
| Catalog # | ABIN634801 |
| Price | |
| Order / More Info | Left-Right Determination Factor 2 (LEFTY2) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |