| Edit |   |
| Antigenic Specificity | DEAH (Asp-Glu-Ala-His) Box Polypeptide 15 (DHX15) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat, Arabidopsis |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | DHX15 is a putative ATP-dependent RNA helicase implicated in pre-mRNA splicing. |
| Immunogen | DHX15 antibody was raised using a synthetic peptide corresponding to a region with amino acids YINIRKALVTGYFMQVAHLERTGHYLTVKDNQVVQLHPSTVLDHKPEWVL |
| Other Names | im:2639158|wu:fb38f09|wu:fk62f05|DDBDRAFT_0186395|DDBDRAFT_0233403|DDB_0186395|DDB_0233403|DHX15|DBP1|DDX15|HRH2|PRP43|PRPF43|PrPp43p|Ddx15|mDEAH9|H2R|HH2R |
| Gene, Accession # | Gene ID: 1665,13204,289693 |
| Catalog # | ABIN633263 |
| Price | |
| Order / More Info | DEAH (Asp-Glu-Ala-His) Box Polypeptide 15 (DHX15) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |