| Edit |   |
| Antigenic Specificity | DEAH (Asp-Glu-Ala-His) Box Polypeptide 37 (DHX37) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | DHX37 is a DEAD box protein. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. |
| Immunogen | DHX37 antibody was raised using a synthetic peptide corresponding to a region with amino acids PLTKKEKKVLQKILEQKEKKSQRAEMLQKLSEVQASEAEMRLFYTTSKLG |
| Other Names | DDBDRAFT_0187437|DDBDRAFT_0235265|DDB_0187437|DDB_0235265|im:7151586|wu:fd11d06|zgc:158802|DDX37|Gm1050|Gm451|mKIAA1517 |
| Gene, Accession # | Gene ID: 57647 |
| Catalog # | ABIN633324 |
| Price | |
| Order / More Info | DEAH (Asp-Glu-Ala-His) Box Polypeptide 37 (DHX37) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |