| Edit |   |
| Antigenic Specificity | GOLGA6A |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human (antigen sequence identity: mouse 35%, rat 35%) |
| Isotype | n/a |
| Format | antigen affinity purified |
| Size | 100 μl |
| Concentration | n/a |
| Applications | IHC |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit anti-human GOLGA6A polyclonal antibody. |
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: GVTDGMRESFTVYESQGAVPNTRHQEMEDVIRLA |
| Other Names | golgin A6 family, member A, GLP, GOLGA6 |
| Gene, Accession # | Gene ID: 342096, UniProt: Q9NYA3, ENSG00000159289 |
| Catalog # | HPA044978 |
| Price | |
| Order / More Info | GOLGA6A Antibody from ATLAS ANTIBODIES AB |
| Product Specific References | n/a |