| Edit |   |
| Antigenic Specificity | NDUFS5 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human (antigen sequence identity: mouse 77%, rat 75%) |
| Isotype | n/a |
| Format | antigen affinity purified |
| Size | 100 μl |
| Concentration | n/a |
| Applications | IHC, WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit anti-human NDUFS5 polyclonal antibody. |
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: KECKIEYDDFVECLLRQKTMRRAGTIRKQRDKLIKEGKYTPPPHHIGK |
| Other Names | NADH dehydrogenase (ubiquinone) Fe-S protein 5, 15kDa (NADH-coenzyme Q reductase), CI-15k |
| Gene, Accession # | Gene ID: 4725, UniProt: O43920, ENSG00000168653 |
| Catalog # | HPA042582 |
| Price | |
| Order / More Info | NDUFS5 Antibody from ATLAS ANTIBODIES AB |
| Product Specific References | n/a |