| Edit |   |
|---|
| Antigenic Specificity | DIS3 Mitotic Control Homolog (S. Cerevisiae) (DIS3) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 μg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | DIS3, belonging to the ribonuclease II (RNB) family, has a 3'-5' exonuclease activity. It is a catalytic component of the exosome 3'->5' exoribonuclease complex required for the 3'-processing of the 7S pre-RNA to the mature 5.8S rRNA and for mRNA decay. The protein is implicated in mitotic control and essential for cell division and spore germination. It may be involved in regulating protein dephosphorylation during mitosis. |
|---|
| Immunogen | DIS3 antibody was raised using a synthetic peptide corresponding to a region with amino acids DIVAVELLPKSQWVAPSSVVLHDEGQNEEDVEKEEETERMLKTAVSEKML |
|---|
| Other Names | DIS3|KIAA1008|EXOSC11|RP11-342J4.3|RRP44|bA555G22.1|dis3p|2810028N01Rik|RGD1304646 |
|---|
| Gene, Accession # | Gene ID: 22894 |
|---|
| Catalog # | ABIN633251 |
|---|
| Price | |
|---|
| Order / More Info | DIS3 Mitotic Control Homolog (S. Cerevisiae) (DIS3) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|