| Edit |   |
| Antigenic Specificity | Kaptin (Actin Binding Protein) (KPTN) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | KPTN may be involved in actin dynamics. KPTN may play a role in producing the sensory apparatus in hair cells. KPTN may also play a role in actin rearrangements that accompany platelet activation and stereocilia formation. |
| Immunogen | Kaptin antibody was raised using a synthetic peptide corresponding to a region with amino acids MGEAAVAAGPCPLREDSFTRFSSQSNVYGLAGGAGGRGELLAATLKGKVL |
| Other Names | 2310042D10Rik|2E4|C030013F01Rik|wu:fc13b08|wu:fc13b09|zgc:100793 |
| Gene, Accession # | Gene ID: 11133,70394,308107 |
| Catalog # | ABIN631596 |
| Price | |
| Order / More Info | Kaptin (Actin Binding Protein) (KPTN) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |