| Edit |   |
|---|
| Antigenic Specificity | Glycerol-3-Phosphate Dehydrogenase 1 (Soluble) (GPD1) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 μg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | GPD1L belongs to the NAD-dependent glycerol-3-phosphate dehydrogenase family. Defects in GPD1L are the cause of Brugada syndrome type 2 (BRS2) and sudden infant death syndrome (SIDS). |
|---|
| Immunogen | GPD1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TFLESCGVADLITTCYGGRNRKVAEAFARTGKSIEQLEKELLNGQKLQGP |
|---|
| Other Names | CG9042|DROGPDHA|DmG3PDH|Dmel\\CG9042|G3PDH|G3pdh|GAPDH|GPD|GPDA|GPDH|GPDH-1|Gdh|Gpd|alpha-GPD|alpha-GPDH|alpha-GPDH-1|alpha-Gpdh|alphaGPDH|alphaGpd|alphaGpdh|alphaGpdh-1|gpdh|gpdh-1|sn-Gpdh|gpd1|MGC79676|GPD1|GPD-C|GPDH-C|LG3P|HTGTI|AI747587|Gdc-1|Gdc1|mKIAA4010|Gpd3|wu:fc30a07|zgc:63859 |
|---|
| Gene, Accession # | Gene ID: 2819 |
|---|
| Catalog # | ABIN631716 |
|---|
| Price | |
|---|
| Order / More Info | Glycerol-3-Phosphate Dehydrogenase 1 (Soluble) (GPD1) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|