| Edit |   |
| Antigenic Specificity | Exportin 1, CRM1 Homolog (Yeast) (XPO1) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | XPO1 mediates leucine-rich nuclear export signal (NES)-dependent protein transport. Exportin 1 specifically inhibits the nuclear export of Rev and U snRNAs. It is also involved in the control of several cellular processes by controlling the localization of cyclin B, MPAK, and MAPKAP kinase 2. This protein also regulates NFAT and AP-1. |
| Immunogen | XPO1 antibody was raised using a synthetic peptide corresponding to a region with amino acids IPAFKEHLRDFLVQIKEFAGEDTSDLFLEEREIALRQADEEKHKRQMSVP |
| Other Names | CG13387|CRM1|Crm1|DCRM1|Dmel\\CG13387|Emb|XPO-1|XPO1|Xpo1|crm1|dCRM1|l(2)k16715|18.m06600|DDBDRAFT_0183812|DDBDRAFT_0234066|DDB_0183812|DDB_0234066|exportin-1|LOC100220104|emb|exp1|Xpo|AA420417|Exp1 |
| Gene, Accession # | Gene ID: 7514 |
| Catalog # | ABIN633201 |
| Price | |
| Order / More Info | Exportin 1, CRM1 Homolog (Yeast) (XPO1) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |