| Edit |   |
| Antigenic Specificity | Exportin, tRNA (Nuclear Export Receptor For TRNAs) (XPOT) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | XPOT belonging to the RAN-GTPase exportin family that mediates export of tRNA from the nucleus to the cytoplasm. Translocation of tRNA to the cytoplasm occurs once exportin has bound both tRNA and GTP-bound RAN. |
| Immunogen | XPOT antibody was raised using a synthetic peptide corresponding to a region with amino acids TVLSDQQKANVEAIMLAVMKKLTYDEEYNFENEGEDEAMFVEYRKQLKLL |
| Other Names | 110.t00019|XPO3|Exportin-T|si:ch211-286m4.4|exportin-T|1110004L07Rik|3110065H13Rik|AI452076|C79645|EXPORTIN-T |
| Gene, Accession # | Gene ID: 11260,73192,314879 |
| Catalog # | ABIN633241 |
| Price | |
| Order / More Info | Exportin, tRNA (Nuclear Export Receptor For TRNAs) (XPOT) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |