| Edit |   |
| Antigenic Specificity | Sec1 Family Domain Containing 1 (SCFD1) (N-Term) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The function of SCFD1 protein is not widely studied, and is yet to be elucidated fully. |
| Immunogen | SCFD1 antibody was raised using the N terminal of SCFD1 corresponding to a region with amino acids SAVTQVAKVFDQYLNFITLEDDMFVLCNQNKELVSYRAINRPDITDTEME |
| Other Names | DDBDRAFT_0188070|DDBDRAFT_0234142|DDB_0188070|DDB_0234142|C14orf163|RA410|SLY1|SLY1P|STXBP1L2|3110021P21Rik|Sly1|rSly1 |
| Gene, Accession # | Gene ID: 23256,76983,54350 |
| Catalog # | ABIN632406 |
| Price | |
| Order / More Info | Sec1 Family Domain Containing 1 (SCFD1) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |