| 產(chǎn)品詳情 |
| Edit |   |
| Antigenic Specificity | Leptin Receptor/LEPR |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100ug (sample available) |
| Concentration | 500ug/ml. |
| Applications | ELISA, IHC |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit IgG polyclonal Picoband? antibody for Leptin receptor(LEPR) detection. Tested with IHC-P, ELISA in Human;Mouse;Rat. No cross reactivity with other proteins. Leptin receptor, also known as LEP-R or OB-R is a protein that in humans is encoded by the LEPR gene. The protein encoded by this gene belongs to the gp130 family of cytokine receptors that are known to stimulate gene transcription via activation of cytosolic STAT proteins. This protein is a receptor for leptin (an adipocyte-specific hormone that regulates body weight), and is involved in the regulation of fat metabolism, as well as in a novel hematopoietic pathway that is required for normal lymphopoiesis. Mutations in this gene have been associated with obesity and pituitary dysfunction. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human Leptin Receptor (793-839aa KKYYIHDHFIPIEKYQFSLYPIFMEGVGKPKIINSFTQDDIEKHQSD), different from the related mouse sequence by nine amino acids, and from the related rat sequence by eig |
| Other Names | Leptin receptor;LEP-R;HuB219;OB receptor;OB-R;CD295;LEPR;DB, OBR; |
| Gene, Accession # | LEPR, UniProt: P48357 |
| Catalog # | A00350 |
| Price | |
| Order / More Info | Leptin Receptor/LEPR Antibody from BOSTER BIO |
| Product Specific References | n/a |
| 產(chǎn)品資料 |
|
|