| Edit |   |
| Antigenic Specificity | Neuromedin B Receptor (NMBR) (N-Term) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Neuromedin B receptor binds neuromedin B, a potent mitogen and growth factor for normal and neoplastic lung and for gastrointestinal epithelial tissue. |
| Immunogen | NMBR antibody was raised using the N terminal of NMBR corresponding to a region with amino acids PSKSLSNLSVTTGANESGSVPEGWERDFLPASDGTTTELVIRCVIPSLYL |
| Other Names | NMBR|si:ch211-59d15.2|si:dkey-283f18.1|BB182387|NMB-R |
| Gene, Accession # | Gene ID: 4829 |
| Catalog # | ABIN634529 |
| Price | |
| Order / More Info | Neuromedin B Receptor (NMBR) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |