| Edit |   |
| Antigenic Specificity | SYT1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human (antigen sequence identity: mouse 85%, rat 87%) |
| Isotype | n/a |
| Format | antigen affinity purified |
| Size | 100 μl |
| Concentration | n/a |
| Applications | IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues., Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein., Recombinant expression validation in WB using target protein overexpression. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit anti-human SYT1 polyclonal antibody. |
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: MVSESHHEALAAPPVTTVATVLPSNATEPASPGEGKEDAFSKLKEKFMNELH |
| Other Names | synaptotagmin I, P65, SVP65, SYT |
| Gene, Accession # | Gene ID: 6857, UniProt: P21579, ENSG00000067715 |
| Catalog # | HPA064788 |
| Price | |
| Order / More Info | SYT1 Antibody from ATLAS ANTIBODIES AB |
| Product Specific References | n/a |