If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY.
Description
n/a
Immunogen
Fusion protein amino acids 1505-1546 (SSIVDAGLVLVFSEGILVECDTGPNLLQHKNGLFSTLVMTNK, cytoplasmic C-terminus) of mouse SUR2A (also known as Sulfonylurea receptor 2A, ATP-binding cassette transporter sub-family C member 9A and Abcc9A, accession number P70170); Rat: 97% identity (41/42 amino acids identical); Human: 92% identity (39/42 amino acids identical); 100% identity with SUR2C<50% identity with SUR2B
Other Names
ATP-binding cassette sub-family C member 9 (Sulfonylurea receptor 2)