| 產(chǎn)品詳情 |
| Edit |   |
| Antigenic Specificity | SUR1/ABCC8 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | unconjugated |
| Size | 100ug (sample available) |
| Concentration | 0.5-1mg/ml, actual concentration varies by lot. |
| Applications | Flow Cytometry, IHC, ICC, WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit IgG polyclonal Picoband? antibody for SUR1 detection. Tested with WB, IHC-F, ICC, FCM in Human;Mouse;Rat. No cross reactivity with other proteins. ATP-binding cassette transporter sub-family C member 8 is a protein that in humans is encoded by the ABCC8 gene. The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MRP subfamily which is involved in multi-drug resistance. This protein functions as a modulator of ATP-sensitive potassium channels and insulin release. Mutations and deficiencies in this protein have been observed in patients with hyperinsulinemic hypoglycemia of infancy, an autosomal recessive disorder of unregulated and high insulin secretion. Mutations have also been associated with non-insulin-dependent diabetes mellitus type II, an autosomal dominant disease of defective insulin secretion. Alternatively spliced transcript variants have been found for this gene. |
| Immunogen | A synthetic peptide corresponding to a sequence of human SUR1 (TIQREGTLKDFQRSECQLFEHWKTLMNRQDQELEKETVTERKA). |
| Other Names | ATP-binding cassette sub-family C member 8; Sulfonylurea receptor 1; ABCC8; HRINS; SUR; SUR1 |
| Gene, Accession # | ABCC8, UniProt: Q09428 |
| Catalog # | A00895-1 |
| Price | |
| Order / More Info | SUR1/ABCC8 Antibody from BOSTER BIO |
| Product Specific References | n/a |
| 產(chǎn)品資料 |
|
|