| Edit |   |
| Antigenic Specificity | Glucuronidase, beta (GUSB) (C-Term) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | purified |
| Size | 100 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB),Immunohistochemistry (IHC) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | GUSB plays an important role in the degradation of dermatan and keratan sulfates. |
| Immunogen | GUSB antibody was raised using the C terminal of GUSB corresponding to a region with amino acids VLGNKKGIFTRQRQPKSAAFLLRERYWKIANETRYPHSVAKSQCLENSPF |
| Other Names | GUSB|beta-GUS|gus|BG|MPS7|AI747421|Gur|Gus|Gus-r|Gus-s|Gus-t|Gus-u|Gut|asd|g|Ac2-223|si:ch211-160e1.7|si:ct573103.7 |
| Gene, Accession # | Gene ID: 2990 |
| Catalog # | ABIN630431 |
| Price | |
| Order / More Info | Glucuronidase, beta (GUSB) (C-Term) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |