| Edit |   |
| Antigenic Specificity | PCP4 |
| Clone | CL5306 |
| Host Species | Mouse |
| Reactive Species | human, mouse, rat (antigen sequence identity: mouse 96%, rat 96%) |
| Isotype | IgG1 |
| Format | Protein A purified |
| Size | 100 μl |
| Concentration | n/a |
| Applications | IHC |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Mouse anti-human PCP4 monoclonal antibody. Binds to an epitope located within the peptide sequence RAAVAIQSQFRKFQK as determined by overlapping synthetic peptides. |
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: GAGATNGKDKTSGENDGQKKVQEEFDIDMDAPETERAAVAIQSQFRKFQKKK |
| Other Names | Purkinje cell protein 4, PEP-19 |
| Gene, Accession # | Gene ID: 5121, UniProt: P48539, ENSG00000183036 |
| Catalog # | AMAb91359 |
| Price | |
| Order / More Info | PCP4 Antibody from ATLAS ANTIBODIES AB |
| Product Specific References | n/a |