| Edit |   |
| Antigenic Specificity | Superoxide Dismutase 1, Soluble (SOD1) (N-Term) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | purified |
| Size | 100 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB),Immunohistochemistry (IHC) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | SOD1 binds copper and zinc ions and is one of two isozymes responsible for destroying free superoxide radicals in the body. This isozyme is a soluble cytoplasmic protein, acting as a homodimer to convert naturally-occuring but harmful superoxide radicals to molecular oxygen and hydrogen peroxide. The other isozyme is a mitochondrial protein. Mutations in its gene have been implicated as causes of familial amyotrophic lateral sclerosis. |
| Immunogen | SOD1 antibody was raised using the N terminal of SOD1 corresponding to a region with amino acids MATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHE |
| Other Names | sod1|SODC|DKFZP469M1833|LOC692639|ALS|Albs|mKIAA4111|Als|CG11793|Cu|Cu-Zn SOD|Cu/Zn SOD|Cu/Zn sod|Cu/Zn superoxide dismutase|Cu/ZnSOD|CuSOD|CuZn SOD|CuZn-SOD|CuZn-SOD1|CuZnSOD|Cu[2+]/Zn[2+]SOD|Dmel\\CG11793|G|Mn SOD|SOD|SOD-1|SOD1|Sod-1|Sod1|To|To-1|Zn SOD|Zn Sod|Zn-SOD|ZnSod|cSOD|cSod|dSOD1|l(3)108|l(3)68Af'|l(3)G|sod|ALS1|IPOA|hSod1|homodimer|B430204E11Rik|Cu/Zn-SOD|Ipo-1|Ipo1|CU/ZN-SOD|SOD1L1|ZSOD|cuzn|XSODB|als|als1|ipoa|sod1-a |
| Gene, Accession # | Gene ID: 6647 |
| Catalog # | ABIN630121 |
| Price | |
| Order / More Info | Superoxide Dismutase 1, Soluble (SOD1) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |