If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY.
Description
Rabbit IgG polyclonal Picoband? antibody for Zinc finger protein SNAI2(SNAI2) detection. Tested with WB, IHC-P in Human;Mouse;Rat. No cross reactivity with other proteins. SLUG is also known as SNAI2. This gene encodes a member of the Snail family of C2H2-type zinc finger transcription factors. The encoded protein acts as a transcriptional repressor that binds to E-box motifs and is also likely to repress E-cadherin transcription in breast carcinoma. This protein is involved in epithelial-mesenchymal transitions and has antiapoptotic activity. Mutations in this gene may be associated with sporatic cases of neural tube defects.
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human SLUG (116-148aa KLSDPHAIEAEKFQCNLCNKTYSTFSGLAKHKQ), identical to the related mouse and rat sequences.