| 產(chǎn)品詳情 |
| Edit |   |
| Antigenic Specificity | Glucose 1-dehydrogenase |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Glucose 1-dehydrogenase Antibody from Novus Biologicals is a rabbit polyclonal antibody to Glucose 1-dehydrogenase. This antibody reacts with human. The Glucose 1-dehydrogenase Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence. |
| Immunogen | Synthetic peptides corresponding to H6PD(hexose-6-phosphate dehydrogenase (glucose 1-dehydrogenase)) The peptide sequence was selected from the N terminal of H6PD. Peptide sequence HFSAQQLATELGTFFQEEEMYRVDHYLGKQAVAQILPFRDQNRKALDGLW. |
| Other Names | 6-phosphogluconolactonase, DKFZp686A01246, EC 1.1.1.49, EC 2.7.4.3, EC 3.1.1.31, G6PD, H form, G6PDH, GDH/6PGL endoplasmic bifunctional protein, GDHglucose 1- dehydrogenase, glucose dehydrogenase, glucose dehyrogenase, glucose-6-phosphate dehydrogenase, salivary, hexose-6-phosphate dehydrogenase (glucose 1-dehydrogenase), MGC87643 |
| Gene, Accession # | H6PD, Gene ID: 9563, Accession: O95479, SwissProt: O95479 |
| Catalog # | NBP1-57903 |
| Price | |
| Order / More Info | Glucose 1-dehydrogenase Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 產(chǎn)品資料 |
|
|