| Edit |   |
| Antigenic Specificity | HSD17B6 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human (antigen sequence identity: mouse 48%, rat 44%) |
| Isotype | n/a |
| Format | antigen affinity purified |
| Size | 100 μl |
| Concentration | n/a |
| Applications | IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit anti-human HSD17B6 polyclonal antibody. |
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: VEPGYFRTGMTNMTQSLERMKQSWKEAPKHIKETYGQQYFDALYNIMKEGLL |
| Other Names | hydroxysteroid (17-beta) dehydrogenase 6, HSE, RODH, SDR9C6 |
| Gene, Accession # | Gene ID: 8630, UniProt: O14756, ENSG00000025423 |
| Catalog # | HPA059141 |
| Price | |
| Order / More Info | HSD17B6 Antibody from ATLAS ANTIBODIES AB |
| Product Specific References | n/a |