| Edit |   |
| Antigenic Specificity | HSD3B1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human (antigen sequence identity: mouse 84%, rat 89%) |
| Isotype | n/a |
| Format | antigen affinity purified |
| Size | 100 μl |
| Concentration | n/a |
| Applications | IHC |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit anti-human HSD3B1 polyclonal antibody. |
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: RHIVTLSNSVFTFSYKKAQRDLAYKPLYSWEEAKQKT |
| Other Names | hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 1, HSD3B, HSDB3, SDR11E1 |
| Gene, Accession # | Gene ID: 3283, UniProt: P14060, ENSG00000203857 |
| Catalog # | HPA043264 |
| Price | |
| Order / More Info | HSD3B1 Antibody from ATLAS ANTIBODIES AB |
| Product Specific References | n/a |