| Edit |   |
| Antigenic Specificity | Steroid Sulfatase (Microsomal), Isozyme S (STS) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | purified |
| Size | 100 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | STS catalyzes the conversion of sulfated steroid precursors to estrogens during pregnancy. The protein is found in the endoplasmic reticulum, where it acts as a homodimer. Mutations in its gene are known to cause X-linked ichthyosisThe protein encoded by this gene catalyzes the conversion of sulfated steroid precursors to estrogens during pregnancy. The encoded protein is found in the endoplasmic reticulum, where it acts as a homodimer. Mutations in this gene are known to cause X-linked ichthyosis (XLI). |
| Immunogen | STS antibody was raised using a synthetic peptide corresponding to a region with amino acids LLFDISKDPRERNPLTPASEPRFYEILKVMQEAADRHTQTLPEVPDQFSW |
| Other Names | abcg2|ArsC|ARSC|ARSC1|ASC|ES|SSDD|XLI |
| Gene, Accession # | Gene ID: 412 |
| Catalog # | ABIN630487 |
| Price | |
| Order / More Info | Steroid Sulfatase (Microsomal), Isozyme S (STS) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |