| Edit |   |
| Antigenic Specificity | Chemokine-Like Factor (CKLF) (N-Term) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | CKLF is a cytokine. This gene is one of several chemokine-like factor genes located in a cluster on chromosome 16. CKLF is a potent chemoattractant for neutrophils, monocytes and lymphocytes. It also can stimulate the proliferation of skeletal muscle cells. This protein may play important roles in inflammation and in the regeneration of skeletal muscle. |
| Immunogen | CKLF antibody was raised using the N terminal of CKLF corresponding to a region with amino acids MDNVQPKIKHRPFCFSVKGHVKMLRLALTVTSMTFFIIAQAPEPYIVITG |
| Other Names | C32|CKLF1|CKLF2|CKLF3|CKLF4|UCK-1|1700001C14Rik|1810018M11Rik|CKLF5|Cklf2|Cklf6|HSPC224|Cklf1 |
| Gene, Accession # | Gene ID: 51192 |
| Catalog # | ABIN634980 |
| Price | |
| Order / More Info | Chemokine-Like Factor (CKLF) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |