| Edit |   |
| Antigenic Specificity | Nucleobindin 1 (NUCB1) (C-Term) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | purified |
| Size | 100 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Calnuc or NUCB1 belongs to the nucleobindin family. It is a major calcium-binding protein of the Golgi and is a good Golgi marker. It may be involved in calcium homeostasis. Calnuc also plays roles in regulation of levels of amyloid precursor protein (APP) and its proteolytic metabolites to further affect the patho/physiological functions of APP including Alzheimer's disease pathogenesis. |
| Immunogen | Nucleobindin 1 antibody was raised using the C terminal of NUCB1 corresponding to a region with amino acids PAAHPEGQLKFHPDTDDVPVPAPAGDQKEVDTSEKKLLERLPEVEVPQHL |
| Other Names | nuc|MGC69294|MGC81496|NUCB1|zgc:153192|DKFZp459O1814|B230337F23Rik|C77483|Calnuc|MTEST82|Nucb|CALNUC|NUC |
| Gene, Accession # | Gene ID: 4924 |
| Catalog # | ABIN630154 |
| Price | |
| Order / More Info | Nucleobindin 1 (NUCB1) (C-Term) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |