| Edit |   |
| Antigenic Specificity | InaD-Like (Drosophila) (INADL) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | INADL is a protein with multiple PDZ domains. PDZ domains mediate protein-protein interactions, and proteins with multiple PDZ domains often organize multimeric complexes at the plasma membrane. This protein localizes to tight junctions and to the apical membrane of epithelial cells. A similar protein in Drosophila is a scaffolding protein which tethers several members of a multimeric signaling complex in photoreceptors. |
| Immunogen | INADL antibody was raised using a synthetic peptide corresponding to a region with amino acids EVMVATLDTQIADDAELQKYSKLLPIHTLRLGVEVDSFDGHHYISSIVSG |
| Other Names | wu:fc76h08|si:dz129i22.4|si:busm1-129i22.4|Cipp|InaD-like|PATJ|hINADL|Patj|Inadl2|RGD1565362 |
| Gene, Accession # | Gene ID: 10207 |
| Catalog # | ABIN634346 |
| Price | |
| Order / More Info | InaD-Like (Drosophila) (INADL) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |