| Edit |   |
| Antigenic Specificity | SSR1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat (antigen sequence identity: mouse 98%, rat 100%) |
| Isotype | n/a |
| Format | antigen affinity purified |
| Size | 100 μl |
| Concentration | n/a |
| Applications | ICC-IF, IHC, WB. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein., Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit anti-human SSR1 polyclonal antibody. |
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: ESRKRKRPIQKVEMGTSSQNDVDMSWIPQETLNQINKASPRRLPRKRAQKRSVGSDE |
| Other Names | signal sequence receptor, alpha, TRAPA |
| Gene, Accession # | Gene ID: 6745, UniProt: P43307, ENSG00000124783 |
| Catalog # | HPA011276 |
| Price | |
| Order / More Info | SSR1 Antibody from ATLAS ANTIBODIES AB |
| Product Specific References | n/a |