| 產(chǎn)品詳情 |
| Edit |   |
| Antigenic Specificity | ACCN1/ASIC2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100ug (sample available) |
| Concentration | 500ug/ml. |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit IgG polyclonal Picoband? antibody for Acid-sensing ion channel 2(ASIC2) detection. Tested with WB in Human;Rat. No cross reactivity with other proteins. Amiloride-sensitive cation channel 1, neuronal, also known as ASIC2, is a protein that in humans is encoded by the ACCN1 gene. This gene encodes a member of the degenerin/epithelial sodium channel (DEG/ENaC) superfamily. The members of this family are amiloride-sensitive sodium channels that contain intracellular N and C termini, 2 hydrophobic transmembrane regions, and a large extracellular loop, which has many cysteine residues with conserved spacing. The member encoded by this gene may play a role in neurotransmission. In addition, a heteromeric association between this member and acid-sensing (proton-gated) ion channel 3 has been observed to co-assemble into proton-gated channels sensitive to gadolinium. Alternative splicing has been observed at this locus and two variants, encoding distinct isoforms, have been identified. |
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human ACCN1 (112-147aa ELLALLDVNLQIPDPHLADPSVLEALRQKANFKHYK), different from the related mouse and rat sequences by one amino acid. |
| Other Names | Acid-sensing ion channel 2;ASIC2;Amiloride-sensitive brain sodium channel;Amiloride-sensitive cation channel 1, neuronal;Amiloride-sensitive cation channel neuronal 1;Brain sodium channel 1;BNC1;BNaC1;Mammalian degenerin homolog;ASIC2;ACCN, ACCN1, BNAC1, MDEG; |
| Gene, Accession # | ASIC2, UniProt: Q16515 |
| Catalog # | PB10046 |
| Price | |
| Order / More Info | ACCN1/ASIC2 Antibody from BOSTER BIO |
| Product Specific References | n/a |
| 產(chǎn)品資料 |
|
|