| Edit |   |
| Antigenic Specificity | Glycine-N-Acyltransferase-Like 2 (GLYATL2) (Middle Region) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | GLYATL2 belongs to the glycine N-acyltransferase family. GLYATL2 is a mitochondrial acyltransferase which transfers the acyl group to the N-terminus of glycine. It can conjugate a multitude of substrates to form a variety of N-acylglycines. |
| Immunogen | GLYATL2 antibody was raised using the middle region of GLYATL2 corresponding to a region with amino acids LDEAIRKVATSKSVQVDYMKTILFIPELPKKHKTSSNDKMELFEVDDDNK |
| Other Names | BXMAS2-10|GATF-B |
| Gene, Accession # | Gene ID: 219970 |
| Catalog # | ABIN631098 |
| Price | |
| Order / More Info | Glycine-N-Acyltransferase-Like 2 (GLYATL2) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |