| Edit |   |
| Antigenic Specificity | Glycine-N-Acyltransferase-Like 3 (GLYATL3) (N-Term) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | C6orf140 encodes an acyltransferase which transfers the acyl group to the N-terminus of glycine. |
| Immunogen | C6 ORF140 antibody was raised using the N terminal Of C6 rf140 corresponding to a region with amino acids NPFQKEVVLDSWPDFKAVITRRQREAETDNLDHYTNAYAVFYKDVRAYRQ |
| Other Names | C6orf140|bA28H17.2|Gm5683|EG435528 |
| Gene, Accession # | Gene ID: 389396 |
| Catalog # | ABIN631402 |
| Price | |
| Order / More Info | Glycine-N-Acyltransferase-Like 3 (GLYATL3) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |