| Edit |   |
| Antigenic Specificity | SLC35B2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human (antigen sequence identity: mouse 89%, rat 91%) |
| Isotype | n/a |
| Format | antigen affinity purified |
| Size | 100 μl |
| Concentration | n/a |
| Applications | IHC |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit anti-human SLC35B2 polyclonal antibody. |
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: FRRKNYLETGRGLCFPLVKACVFGNEPKASDEVPLAPRTEAAETT |
| Other Names | solute carrier family 35 (adenosine 3'-phospho 5'-phosphosulfate transporter), member B2, UGTrel4 |
| Gene, Accession # | Gene ID: 347734, UniProt: Q8TB61, ENSG00000157593 |
| Catalog # | HPA029638 |
| Price | |
| Order / More Info | SLC35B2 Antibody from ATLAS ANTIBODIES AB |
| Product Specific References | n/a |