| Edit |   |
| Antigenic Specificity | Oxysterol Binding Protein-Like 8 (OSBPL8) (N-Term) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | OSBPL8 is a member of the oxysterol-binding protein (OSBP) family, a group of intracellular lipid receptors. Like most members, OSBPL8 contains an N-terminal pleckstrin homology domain and a highly conserved C-terminal OSBP-like sterol-binding domain. |
| Immunogen | OSBPL8 antibody was raised using the N terminal of OSBPL8 corresponding to a region with amino acids SQRQGKEAYPTPTKDLHQPSLSPASPHSQGFERGKEDISQNKDESSLSMS |
| Other Names | RGD1561474|DKFZp469P0923|MST120|MSTP120|ORP8|OSBP10|AA536976|AA536995|C730029P18Rik|D330025H14Rik|ORP-8 |
| Gene, Accession # | Gene ID: 114882 |
| Catalog # | ABIN635298 |
| Price | |
| Order / More Info | Oxysterol Binding Protein-Like 8 (OSBPL8) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |