| Edit |   |
| Antigenic Specificity | DYRK1B |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human (antigen sequence identity: mouse 100%, rat 100%) |
| Isotype | n/a |
| Format | antigen affinity purified |
| Size | 100 μl |
| Concentration | n/a |
| Applications | IHC, WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit anti-human DYRK1B polyclonal antibody. |
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: LVLRMLEYEPAARISPLGALQHGFFRRTADEATNTGPAGSSASTSPAPLDTCPSSSTASSISSS |
| Other Names | dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1B, MIRK |
| Gene, Accession # | Gene ID: 9149, UniProt: Q9Y463, ENSG00000105204 |
| Catalog # | HPA028786 |
| Price | |
| Order / More Info | DYRK1B Antibody from ATLAS ANTIBODIES AB |
| Product Specific References | n/a |