| Edit |   |
|---|
| Antigenic Specificity | TFF1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human (antigen sequence identity: mouse 64%, rat 66%) |
|---|
| Isotype | n/a |
|---|
| Format | antigen affinity purified |
|---|
| Size | 100 μl |
|---|
| Concentration | n/a |
|---|
| Applications | IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues., Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines., Recombinant expression validation in WB using target protein overexpression. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit anti-human TFF1 polyclonal antibody. |
|---|
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: QTETCTVAPRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFYPNTIDVPPE |
|---|
| Other Names | trefoil factor 1, BCEI, D21S21, HP1.A, HPS2, pNR-2, pS2 |
|---|
| Gene, Accession # | Gene ID: 7031, UniProt: P04155, ENSG00000160182 |
|---|
| Catalog # | HPA003425 |
|---|
| Price | |
|---|
| Order / More Info | TFF1 Antibody from ATLAS ANTIBODIES AB |
|---|
| Product Specific References | n/a |
|---|