| Edit |   |
|---|
| Antigenic Specificity | Endoplasmic Reticulum Protein 44 (ERP44) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 μg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | TXNDC4 mediates thiol-dependent retention in the early secretory pathway, forming mixed disulfides with substrate proteins through its conserved CRFS motif. TXNDC4 inhibits the calcium channel activity of ITPR1. TXNDC4 may have a role in the control of oxidative protein folding in the endoplasmic reticulum. TXNDC4 is required to retain ERO1L and ERO1LB in the endoplasmic reticulum. |
|---|
| Immunogen | TXNDC4 antibody was raised using a synthetic peptide corresponding to a region with amino acids LHREFHHGPDPTDTAPGEQAQDVASSPPESSFQKLAPSEYRYTLLRDRDE |
|---|
| Other Names | PDIA10|TXNDC4|1110001E24Rik|AI849526|AL033348|Txndc4|BWK4|txndc4|zgc:77883 |
|---|
| Gene, Accession # | Gene ID: 23071,76299,298066 |
|---|
| Catalog # | ABIN632154 |
|---|
| Price | |
|---|
| Order / More Info | Endoplasmic Reticulum Protein 44 (ERP44) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|