| Edit |   |
|---|
| Antigenic Specificity | COP9 Constitutive Photomorphogenic Homolog Subunit 4 (Arabidopsis) (COPS4) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 μg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | COPS4 is one of eight subunits composing COP9 signalosome, a highly conserved protein complex that functions as an important regulator in multiple signaling pathways. The structure and function of COP9 signalosome is similar to that of the 19S regulatory particle of 26S proteasome. COP9 signalosome has been shown to interact with SCF-type E3 ubiquitin ligases and act as a positive regulator of E3 ubiquitin ligases. |
|---|
| Immunogen | COPS4 antibody was raised using a synthetic peptide corresponding to a region with amino acids YKLETYLKIARLYLEDDDPVQAEAYINRASLLQNESTNEQLQIHYKVCYA |
|---|
| Other Names | CG8725|CH4|Cops4|Csn4|DCH4|Dch4|Dmel\\CG8725|csn4|l(2)k08018|COPS4|SGN4|DKFZp459H0324|AW208976|D5Ertd774e|fc90c08|wu:fc90c08|zgc:77137|ATS4|CONSTITUTIVE PHOTOMORPHOGENIC 14|CONSTITUTIVE PHOTOMORPHOGENIC 8|COP14|COP9 SIGNALOSOME SUBUNIT 4|CSN4|EMB134|EMBRYO DEFECTIVE 134|FUS4|FUS8|FUSCA 4|FUSCA 8|MBD2.17|MBD2_17|COS41.8 |
|---|
| Gene, Accession # | Gene ID: 51138,26891,360915 |
|---|
| Catalog # | ABIN632182 |
|---|
| Price | |
|---|
| Order / More Info | COP9 Constitutive Photomorphogenic Homolog Subunit 4 (Arabidopsis) (COPS4) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|