| Edit |   |
| Antigenic Specificity | Family with Sequence Similarity 71, Member A (FAM71A) (C-Term) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | FAM71A belongs to the FAM71 family. The exact function of C15orf27 remains unknown. |
| Immunogen | FAM71 A antibody was raised using the C terminal of FAM71 corresponding to a region with amino acids DKIAQKSSSRSSFSHRANRDDKKEKGCGNPGSSRHRDSHKGVSHTPISKE |
| Other Names | RGD1561646|GARI-L4|4933417M04Rik|RP11-338C15.4 |
| Gene, Accession # | Gene ID: 149647 |
| Catalog # | ABIN632763 |
| Price | |
| Order / More Info | Family with Sequence Similarity 71, Member A (FAM71A) (C-Term) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |