| Edit |   |
| Antigenic Specificity | Family with Sequence Similarity 101, Member A (FAM101A) (Middle Region) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | FAM101A belongs to the FAM101 family. The exact function of FAM101A remains unknown. |
| Immunogen | FAM101 A antibody was raised using the middle region of FAM101 corresponding to a region with amino acids QLTLEPRPRALRFRSTTIIFPKHARSTFRTTLHCSLGRPSRWFTASVQLQ |
| Other Names | cfm|si:bz71m17.1|si:rp71-71m17.1|3110032G18Rik|cfm2 |
| Gene, Accession # | Gene ID: 144347 |
| Catalog # | ABIN631974 |
| Price | |
| Order / More Info | Family with Sequence Similarity 101, Member A (FAM101A) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |