| Edit |   |
| Antigenic Specificity | Family with Sequence Similarity 118, Member A (FAM118A) (Middle Region) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The function of FAM118 protein is not widely studied, and is yet to be elucidated fully. |
| Immunogen | FAM118 A antibody was raised using the middle region of FAM118 corresponding to a region with amino acids EVMEVLQNLYRTKSFLFVGCGETLRDQIFQALFLYSVPNKVDLEHYMLVL |
| Other Names | C22orf8|3110048E14Rik|C230014M12Rik |
| Gene, Accession # | Gene ID: 55007 |
| Catalog # | ABIN633127 |
| Price | |
| Order / More Info | Family with Sequence Similarity 118, Member A (FAM118A) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |