| Edit |   |
| Antigenic Specificity | Family with Sequence Similarity 109, Member A (FAM109A) (N-Term) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | the FAM109A protein localizes to the endosome and interacts with the enzyme, inositol polyphosphate 5-phosphatase OCRL-1. Alternate splicing results in multiple transcript variants. |
| Immunogen | FAM109 A antibody was raised using the N terminal of FAM109 corresponding to a region with amino acids HRRWFVLRGNMLFYFEDAASREPVGVIILEGCTVELVEAAEEFAFAVRFA |
| Other Names | IPIP27A|SES1|A230106M15Rik|AU017694|Ses1|RGD1310656 |
| Gene, Accession # | Gene ID: 144717 |
| Catalog # | ABIN632583 |
| Price | |
| Order / More Info | Family with Sequence Similarity 109, Member A (FAM109A) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |