| Edit |   |
| Antigenic Specificity | Family with Sequence Similarity 176, Member A (FAM176A) (N-Term) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | TMEM166 belongs to the FAM176 family. It acts as a regulator of programmed cell death, mediating both autophagy and apoptosis. |
| Immunogen | TMEM166 antibody was raised using the N terminal Of Tmem166 corresponding to a region with amino acids RLPLSHSPEHVEMALLSNILAAYSFVSENPERAALYFVSGVCIGLVLTLA |
| Other Names | Fam176a|RGD1559797|Tmem166|FAM176A|TMEM166|BC014699 |
| Gene, Accession # | Gene ID: 84141 |
| Catalog # | ABIN635222 |
| Price | |
| Order / More Info | Family with Sequence Similarity 176, Member A (FAM176A) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |