| Edit |   |
| Antigenic Specificity | Family with Sequence Similarity 35, Member A (FAM35A) (N-Term) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The function of FAM35 protein is not widely studied, and is yet to be elucidated fully. |
| Immunogen | FAM35 A antibody was raised using the N terminal of FAM35 corresponding to a region with amino acids PDLSGHFLANCMNRHVHVKDDFVRSVSETQNIESQKIHSSRLSDITSSNM |
| Other Names | FAM35A1|bA163M19.1|3110001K24Rik |
| Gene, Accession # | Gene ID: 54537 |
| Catalog # | ABIN632651 |
| Price | |
| Order / More Info | Family with Sequence Similarity 35, Member A (FAM35A) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |