| Edit |   |
| Antigenic Specificity | Family with Sequence Similarity 134, Member B (FAM134B) (Middle Region) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | FAM134B is a cis-Golgi transmembrane protein that may be necessary for the long-term survival of nociceptive and autonomic ganglion neurons. Defects in this gene are a cause of hereditary sensory and autonomic neuropathy type II (HSAN II). |
| Immunogen | FAM134 B antibody was raised using the middle region of FAM134 corresponding to a region with amino acids DFGIGEYINQKKRERSEADKEKSHKDDSELDFSALCPKISLTVAAKELSV |
| Other Names | JK-1|JK1|1810015C04Rik|AU015349 |
| Gene, Accession # | Gene ID: 54463,66270,619558 |
| Catalog # | ABIN635407 |
| Price | |
| Order / More Info | Family with Sequence Similarity 134, Member B (FAM134B) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |