| Edit |   |
| Antigenic Specificity | Family with Sequence Similarity 50, Member B (FAM50B) (N-Term) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | FAM50B may be involved in growth regulation. |
| Immunogen | FAM50 B antibody was raised using the N terminal of FAM50 corresponding to a region with amino acids EQRRERKRKISCLSFALDDLDDQADAAEARRAGNLGKNPDVDTSFLPDRD |
| Other Names | RGD1563458|D6S2654E|X5L|D0H6S2654E|XAP-5-like |
| Gene, Accession # | Gene ID: 26240 |
| Catalog # | ABIN632462 |
| Price | |
| Order / More Info | Family with Sequence Similarity 50, Member B (FAM50B) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |