| Edit |   |
| Antigenic Specificity | Family with Sequence Similarity 46, Member C (FAM46C) (Middle Region) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | FAM46C belongs to the FAM46 family. The exact function of FAM46C remains unknown. |
| Immunogen | FAM46 C antibody was raised using the middle region of FAM46 corresponding to a region with amino acids LIATKNPEEIRGGGLLKYSNLLVRDFRPTDQEEIKTLERYMCSRFFIDFP |
| Other Names | 4930431B09Rik|AI449797|fd14g08|wu:fc56d11|wu:fd14g08|zgc:55510|zgc:66197 |
| Gene, Accession # | Gene ID: 54855 |
| Catalog # | ABIN632520 |
| Price | |
| Order / More Info | Family with Sequence Similarity 46, Member C (FAM46C) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |