| Edit |   |
| Antigenic Specificity | Family with Sequence Similarity 13, Member C (FAM13C) (N-Term) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | FAM13C1 belongs to the FAM13 family. The exact function of FAM13C1 remains unknown. |
| Immunogen | FAM13 C1 antibody was raised using the N terminal of FAM13 1 corresponding to a region with amino acids TEHVVSSQSECQVRAGTPAHESPQNNAFKCQETVRLQPRIDQRTAISPKD |
| Other Names | FAM13C1|Fam13c1|RGD1310149|1200015N20Rik|C030038O19Rik|mKIAA1796 |
| Gene, Accession # | Gene ID: 220965 |
| Catalog # | ABIN632036 |
| Price | |
| Order / More Info | Family with Sequence Similarity 13, Member C (FAM13C) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |